Cat#:RP-3760H;Product Name:Recombinant Human HGF Protein;Synonym:Scatter Factor (SF), Hepatopoietin (HPTA), HGF, HGFB, F-TCF.;Description:Hepatocyte Growth Factor Protein produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa. The HGF is purified by proprietary chromatographic techniques.;Source:Insect cells.;AA Sequence:QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK AFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGT VSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRY EVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPD KGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKT;Purity:Greater than 95.0% as determined by SDS-PAGE.;Bioactivity:The activity was assayed for scattering activity in the MDCK cell assay. The ED50 for this effect is typically at 1.0-5.0 ng/ml (200,000-1,000,000 IU/mg).;Formulation:The sterile protein powder (1 mg/ml) is lyophilized from a solution containing 50mM acetic acid.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Hepatocyte Growth Factor in 50mM acetic acid to a concentration not less than 100µg/ml. Further dilutions should be made using buffer containing protein.;Storage:Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;