Cat#:RP-3759H;Product Name:Recombinant Human HGF B Protein;Synonym:Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatocyte growth factor beta chain.;Description:HGF-B Protein produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The HGF-B is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR QCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLV YGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTS CSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGK VTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMV LGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS.;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:HGF-B protein is supplied in 1xPBS, 50% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.;