Cat#:RP-3758H;Product Name:Recombinant Human HGF A Protein;Synonym:Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatopoeitin-A, Hepatocyte growth factor alpha chain.;Description:HGF-A Protein produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 463 amino acids fragment (32-494) having a total molecular weight of 57.8kDa. The HGF-A is fused with a 4.5kDa amino-terminal hexahistidine tag. The HGF-A is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN RCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKK EFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQP WSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWC FTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTES GKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQ PRPWCYTLDPHTRW;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:HGF-A protein is supplied in 25mM Na. Acetate pH4.8, 1mM EDTA and 50% glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.;