Cat#:RPH-NP377;Product Name:Recombinant Human ZBTB17 / Miz-1 Protein;Synonym:Zinc Finger and BTB Domain-Containing Protein 17, Myc-Interacting Zinc Finger Protein 1, Miz-1, Zinc Finger Protein 151, Zinc Finger Protein 60, ZBTB17, MIZ1, ZNF151, ZNF60;Description:Recombinant Human Zinc Fingerand BTB Domain-Containing Protein 17 Protein is produced in E.coli and the target gene encoding Met1-Ala188 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAAC SEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHA LKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQS AASGAEQTEKADA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human ZBTB17/Miz-1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.25.;Stability:Recombinant Human ZBTB17/Miz-1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human WIF1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human WIF1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human WIF1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;