Cat#:RPH-NP378;Product Name:Recombinant Human α-Amylase 2B / AMY2B Protein;Synonym:Alpha-amylase 2B, 1,4-alpha-D-glucan glucanohydrolase 2B, Carcinoid alpha-amylase, HXA, AMY2, AMY3;Description:Recombinant Human alpha-amylase 2B Protein is produced in Human Cells and the target gene encoding Gln16-Leu511 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPV SYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVP YSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFR LDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGA KLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAV GFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQ IRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISG DKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human α-Amylase 2B/AMY2B Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human α-Amylase 2B/AMY2B Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human α-Amylase 2B/AMY2B Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human alpha-amylase 2B Protein is produced in Human Cells and the target gene encoding Gln16-Leu511 is expressed with a His tag at the C-terminus.