Cat#:RPH-NP379;Product Name:Recombinant Human α-Galactosidase / GLA Protein;Synonym:Alpha-Galactosidase A, Alpha-D-Galactosidase A, Alpha-D-Galactoside Galactohydrolase, Melibiase, Agalsidase, GLA;Description:Recombinant Human alpha-Galactosidase Protein is produced in Human Cells and the target gene encoding Leu32-Leu429 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWM APQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFAD WGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHW RNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMA APLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINR QEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENTM QMSLKDLLVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human α-Galactosidase/GLA Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.;Stability:Recombinant Human α-Galactosidase/GLA Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human α-Galactosidase/GLA Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human α-Galactosidase / GLA Protein
Online Inquiry
Cat#:
RPH-NP379
Product Name:
Recombinant Human α-Galactosidase / GLA Protein
Synonym:
Alpha-Galactosidase A, Alpha-D-Galactosidase A, Alpha-D-Galactoside Galactohydrolase, Melibiase, Agalsidase, GLA
Description:
Recombinant Human alpha-Galactosidase Protein is produced in Human Cells and the target gene encoding Leu32-Leu429 is expressed with a His tag at the C-terminus.