Cat#:RPH-NP380;Product Name:Recombinant Human β-1,4-Galactosyltransferase 3 / B4GALT3 Protein;Synonym:Beta-1,4-galactosyltransferase 3, B4GALT3;Description:Recombinant Human B4GALT3 Protein is produced in Human Cells and the target gene encoding Arg32-His393 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:RSLSALFGRDQGPTFDYSHPRDVYSNLSHLPGAPGGPPAPQGLPYCPERSPLLVGPVSVSFSPVP SLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVI HQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGY SLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKH RGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPR YPPGSSQAFRQEMLQRRPPARPGPLSTANHTALRGSHVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human β-1,4-Galactosyltransferase 3/B4GALT3 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,2mM MgCl2,10%Glycerol,pH7.5.;Stability:Recombinant Human β-1,4-Galactosyltransferase 3/B4GALT3 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human β-1,4-Galactosyltransferase 3/B4GALT3 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human β-1,4-Galactosyltransferase 3/B4GALT3 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,2mM MgCl2,10%Glycerol,pH7.5.
Stability:
Recombinant Human β-1,4-Galactosyltransferase 3/B4GALT3 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human β-1,4-Galactosyltransferase 3/B4GALT3 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.