Cat#:RPH-NP381;Product Name:Recombinant Human β-1,4-Galactosyltransferase 4 / B4GALT4 Protein;Synonym:Beta-1,4-Galactosyltransferase 4, Beta-1,4-GalTase 4, Beta4Gal-T4, b4Gal-T4, UDP-Gal:Beta-GlcNAc Beta-1,4-Galactosyltransferase 4, UDP-Galactose:Beta-N-Acetylglucosamine Beta-1,4-Galactosyltransferase 4, B4GALT4;Description:Recombinant Human B4GALT4 Protein is produced in Human Cells and the target gene encoding Gln39-Ala344 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQA ENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKF NRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFG GVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVN AERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human β-1,4-Galactosyltransferase 4/B4GALT4 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5.;Stability:Recombinant Human β-1,4-Galactosyltransferase 4/B4GALT4 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human β-1,4-Galactosyltransferase 4/B4GALT4 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human β-1,4-Galactosyltransferase 4/B4GALT4 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 7.5.
Stability:
Recombinant Human β-1,4-Galactosyltransferase 4/B4GALT4 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human β-1,4-Galactosyltransferase 4/B4GALT4 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.