Cat#:RPH-NP376;Product Name:Recombinant Human Wnt Inhibitory Factor 1 / WIF1 Protein;Synonym:Wnt Inhibitory Factor 1, WIF-1, WIF1;Description:Recombinant Human Wnt Inhibitory Factor 1 Protein is produced in Human Cells and the target gene encoding Gly29-Trp379 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQA AGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMN SEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGL CVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKC IGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAG AQLRQHTPSLKKAEERRDPPESNYIWVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Wnt Inhibitory Factor 1/WIF1 Protein was lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.5% CHAPS, pH 4.0.;Stability:Recombinant Human Wnt Inhibitory Factor 1/WIF1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human WIF1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human WIF1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human WIF1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;