• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Wnt Inhibitory Factor 1 / WIF1 Protein Online Inquiry

  • Cat#:
  • RPH-NP376
  • Product Name:
  • Recombinant Human Wnt Inhibitory Factor 1 / WIF1 Protein
  • Synonym:
  • Wnt Inhibitory Factor 1, WIF-1, WIF1
  • Description:
  • Recombinant Human Wnt Inhibitory Factor 1 Protein is produced in Human Cells and the target gene encoding Gly29-Trp379 is expressed with a His tag at the C-terminus.
  • Source:
  • Human Cells
  • AA Sequence:
  • GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQA AGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMN SEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGL CVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKC IGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAG AQLRQHTPSLKKAEERRDPPESNYIWVDHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Wnt Inhibitory Factor 1/WIF1 Protein was lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.5% CHAPS, pH 4.0.
  • Stability:
  • Recombinant Human Wnt Inhibitory Factor 1/WIF1 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human WIF1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human WIF1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human WIF1 protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human Vitronectin Protein I Advanced Biomart
  • Online Inquiry

    refresh