Cat#:RPH-NP360;Product Name:Recombinant Human Transforming Growth Factor Receptor Type II / TGFBR2 Protein;Synonym:TGF-beta receptor type-2, TGF-beta type II receptor,TGFBR2, Transforming growth factor-beta receptor type II;Description:Recombinant Human TGF beta receptor II Protein is produced in Human Cells and the target gene encoding Thr23-Asp159 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAV WRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEE YNTSNPDVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Transforming Growth Factor Receptor Type II/TGFBR2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.;Stability:Recombinant Human Transforming Growth Factor Receptor Type II/TGFBR2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human TGFBR2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TGFBR2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TGFBR2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;