Cat#:RPH-NP361;Product Name:Recombinant Human Transforming Growth Factor α / TGFα Protein;Synonym:Protransforming Growth Factor Alpha, TGF-Alpha, EGF-Like TGF, ETGF, TGF Type 1, TGFA;Description:Recombinant Human Transforming Growth Factor alpha Protein is produced in E.coli and the target gene encoding Val41-Val90 is expressed.;Source:E.coli;AA Sequence:VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Transforming Growth Factor α/TGFα Protein was lyophilized from a 0.2 μm filtered solution of 10mM Acetic Acid .;Stability:Recombinant Human Transforming Growth Factor α/TGFα Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human TGFα protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TGFα protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TGFα protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;