Cat#:RPH-NP362;Product Name:Recombinant Human Transforming Growth Factor β-1 / TGFB1 Protein;Synonym:Transforming Growth Factor Beta-1, TGF-Beta-1, Latency-Associated Peptide, LAP, TGFB1, TGFB;Description:Recombinant Human Transforming Growth Factor beta 1 Protein is produced in Human Cells and the target gene encoding Ala279-Ser390 is expressed.;Source:Human Cells;AA Sequence:ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Transforming Growth Factor β-1/TGFB1 Protein was lyophilized from a 0.2 μm filtered solution of 50mM Glycine 50mM NaCl pH4.0.;Stability:Recombinant Human Transforming Growth Factor β-1/TGFB1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human TGFB1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TGFB1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TGFB1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;