Cat#:RPH-NP363;Product Name:Recombinant Human Transforming Growth Factor β-2 / TGFB2 Protein;Synonym:Transforming growth factor beta-2,TGFB2,Polyergin,G-TSF,Glioblastoma-derived T-cell suppressor factor,Cetermin,BSC-1 cell growth inhibitor,TGF-beta-2;Description:Recombinant Human Transforming Growth Factor beta 2 Protein is produced in Human Cells and the target gene encoding Ala303-Ser414 is expressed.;Source:Human Cells;AA Sequence:ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLY NTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Transforming Growth Factor β-2/TGFB2 Protein was lyophilized from a 0.2 μm filtered solution of 4 mM HCl.;Stability:Recombinant Human Transforming Growth Factor β-2/TGFB2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human TGFB2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TGFB2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TGFB2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;