• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Transforming Growth Factor β-3 / TGFB3 Protein Online Inquiry

  • Cat#:
  • RPH-NP364
  • Product Name:
  • Recombinant Human Transforming Growth Factor β-3 / TGFB3 Protein
  • Synonym:
  • Transforming growth factor beta-3,TGFB3,TGF-beta-3,Latency-associated peptide,LAP
  • Description:
  • Recombinant Human/Mouse Transforming Growth Factor beta 3 Protein is produced in Human Cells and the target gene encoding Ala301-Ser412(Tyr340Phe) is expressed.
  • Source:
  • Human Cells
  • AA Sequence:
  • ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLY NTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Transforming Growth Factor β-3/TGFB3 Protein was lyophilized from a 0.2 μm filtered solution of 4 mM HCl.
  • Stability:
  • Recombinant Human Transforming Growth Factor β-3/TGFB3 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human TGFB3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TGFB3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TGFB3 protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human TGFB2 Protein I Advanced Biomart
  • Online Inquiry

    refresh