Cat#:RPH-NP365;Product Name:Recombinant Human Triosephosphate Isomerase / TIM Protein;Synonym:Triosephosphate Isomerase, TIM, Triose-Phosphate Isomerase, TPI1, TPI;Description:Recombinant Human Triosephosphate Isomerase Protein is produced in E.coli and the target gene encoding Met1-Gln249 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPP TAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELI GQKVAHALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGK TATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE FVDIINAKQ;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Triosephosphate Isomerase/TIM Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 10% Glycerol, pH 8.0.;Stability:Recombinant Human Triosephosphate Isomerase/TIM Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Triosephosphate Isomerase/TIM Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;