• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Transaldolase / TALDO1 Protein Online Inquiry

  • Cat#:
  • RPH-NP359
  • Product Name:
  • Recombinant Human Transaldolase / TALDO1 Protein
  • Synonym:
  • Transaldolase, TALDO1, TAL, TALDO, TALDOR
  • Description:
  • Recombinant Human Transaldolase Protein is produced in Human Cells and the target gene encoding Met1-Lys337 is expressed with a His tag at the C-terminus.
  • Source:
  • Human Cells
  • AA Sequence:
  • MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEA IAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYK EAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILD WHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLL GELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERM LTERMFNAENGKVDHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Transaldolase/TALDO1 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0.
  • Stability:
  • Recombinant Human Transaldolase/TALDO1 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human TALDO1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TALDO1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TALDO1 protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human MECR Protein I Advanced Biomart
  • Online Inquiry

    refresh