Cat#:RPH-NP359;Product Name:Recombinant Human Transaldolase / TALDO1 Protein;Synonym:Transaldolase, TALDO1, TAL, TALDO, TALDOR;Description:Recombinant Human Transaldolase Protein is produced in Human Cells and the target gene encoding Met1-Lys337 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEA IAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYK EAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILD WHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLL GELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERM LTERMFNAENGKVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Transaldolase/TALDO1 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0.;Stability:Recombinant Human Transaldolase/TALDO1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Lyophilized recombinant human TALDO1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TALDO1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TALDO1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;