Cat#:RPH-NP358;Product Name:Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial / MECR Protein;Synonym:Trans-2-Enoyl-CoA Reductase Mitochondrial, Nuclear Receptor-Binding Factor 1, HsNrbf-1NRBF-1, MECR, NBRF1;Description:Recombinant Human Trans-2-Enoyl-CoA Reductase Protein is produced in Human Cells and the target gene encoding Pro54-Met373 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSN VTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQP GDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMK NFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLS QWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTMVDHHH HHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial/MECR Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial/MECR Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human MECR protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human MECR protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human MECR protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;