Cat#:RP-6076H;Product Name:Recombinant Human TGFB2 Protein;Synonym:Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.;Description:TGFB2 Protein produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.;Source:Nicotiana benthamiana.;AA Sequence:HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS PCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.;Purity:Greater than 97.0% as determined by SDS-PAGE.;Bioactivity:The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg.;Formulation:Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M-cm H2O not less than 1µg/40µl, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;