Cat#:RPH-NP355;Product Name:Recombinant Human Teratocarcinoma-Derived Growth Factor 1 / TDGF1 / Cripto Protein;Synonym:Teratocarcinoma-derived growth factor 1,Cripto-1 growth factor,CRGF,Epidermal growth factor-like cripto protein CR1,TDGF1,CRIPTO;Description:Recombinant Human Teratocarcinoma-derived growth factor 1 Protein is produced in Human Cells and the target gene encoding Leu31-Ser169 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFC ACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVA SRTPELPPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Teratocarcinoma-Derived Growth Factor 1/TDGF1/Cripto Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human Teratocarcinoma-Derived Growth Factor 1/TDGF1/Cripto Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human TDGF1 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TDGF1 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TDGF1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;