Cat#:RPH-NP354;Product Name:Recombinant Human T Cell Immunoglobulin and Mucin Domain-3 / TIM-3 / HAVCR2 Protein;Synonym:Hepatitis A virus cellular receptor 2, T-cell immunoglobulin and mucin domain-containing protein 3, T-cell membrane protein 3, FLJ14428,KIM-3,Tim-3,TIM3,TIMD3;Description:Recombinant Human TIM-3 Protein is produced in Human Cells and the target gene encoding Ser22-Arg200 is expressed with a Fc, His tag at the C-terminus.;Source:Human Cells;AA Sequence:SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNG DFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTLQRDFTAAFPRM LTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRVDDIEGRMDEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human HAVCR2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human HAVCR2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human HAVCR2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;