Cat#:RPH-NP353;Product Name:Recombinant Human T Cell Immunoglobulin and Mucin Domain-3 / TIM3 / HAVCR2 Protein;Synonym:Hepatitis A Virus Cellular Receptor 2, HAVcr-2, T-Cell Immunoglobulin and Mucin Domain-Containing Protein 3, TIMD-3, T-Cell Membrane Protein 3, TIM-3, HAVCR2, TIM3, TIMD3;Description:Recombinant Human TIM-3 Protein is produced in Human Cells and the target gene encoding Ser22-Arg200 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNG DFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTLQRDFTAAFPRM LTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM3/HAVCR2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM3/HAVCR2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human HAVCR2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human HAVCR2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human HAVCR2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;