Cat#:RPH-NP352;Product Name:Recombinant Human Syndecan-2 / SDC2 / CD362 Protein;Synonym:Syndecan-2, SYND2, Fibroglycan, Heparan Sulfate Proteoglycan Core Protein, HSPG, CD362, SDC2, HSPG1;Description:Recombinant Human Syndecan-2 Protein is produced in Human Cells and the target gene encoding Glu19-Glu144 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAA PKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVDHH HHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Syndecan-2/SDC2/CD362 Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris-Citrate, 150mM NaCl, pH 7.0.;Stability:Recombinant Human Syndecan-2/SDC2/CD362 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human SDC2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human SDC2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human SDC2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;