Cat#:RPH-NP351;Product Name:Recombinant Human Superoxide Dismutase [Cu-Zn] / SOD1 / Cu-Zn SOD Protein;Synonym:Superoxide Dismutase [Cu-Zn], Superoxide Dismutase 1, hSod1, SOD1;Description:Recombinant Human SOD1 Protein is produced in E.coli and the target gene encoding Met1-Gln154 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHG FHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGD HCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Superoxide Dismutase [Cu-Zn]/SOD1/Cu-Zn SOD Protein was supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human Superoxide Dismutase [Cu-Zn]/SOD1/Cu-Zn SOD Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Superoxide Dismutase [Cu-Zn]/SOD1/Cu-Zn SOD Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;