Cat#:RPH-NP350;Product Name:Recombinant Human Sterol O-Acyltransferase 2 / SOAT2 / ACAT2 Protein;Synonym:Acetyl-CoA acetyltransferase cytosolic, Acetyl-CoA transferase-like protein, Cytosolic acetoacetyl-CoA thiolase, ACTL, ACAT2;Description:Recombinant Human Sterol O-acyltransferase 2 Protein is produced in E.coli and the target gene encoding Met1-Glu397 is expressed with a Trx, His tag at the N-terminus.;Source:E. coli;AA Sequence:MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMNAGSDPVVIVSAARTIIGSFNGALAAVPV QDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSG LKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHM GITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRRGLIEVKTDEFPRHG SNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWSQVGVEP SIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPL GASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Sterol O-acyltransferase 2 Protein is produced in E.coli and the target gene encoding Met1-Glu397 is expressed with a Trx, His tag at the N-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.