Cat#:RPH-NP349;Product Name:Recombinant Human Stem Cell Factor / SCF / c-Kit Ligand Protein;Synonym:Kit Ligand, Mast Cell Growth Factor, MGF, Stem Cell Factor, SCF, c-Kit ligand, KITLG, MGF, SCF;Description:Recombinant Human Stem Cell Factor Protein is produced in E.coli and the target gene encoding Glu26-Ala189 is expressed.;Source:E.coli;AA Sequence:MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFS NISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDF VVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^5 IU/mg.;Formulation:Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.;Stability:Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human SCF protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human SCF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human SCF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;