Cat#:RPH-NP348;Product Name:Recombinant Human Sorbitol Dehydrogenase / SORD Protein;Synonym:Sorbitol Dehydrogenase, L-Iditol 2-Dehydrogenase, SORD;Description:Recombinant Human Sorbitol Dehydrogenase Protein is produced in Human Cells and the target gene encoding Ala2-Pro357 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPM VLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCR FYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMG AAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGI YATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRF PLEKALEAFETFKKGLGLKIMLKCDPSDQNPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Sorbitol Dehydrogenase/SORD Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,0.2M NaCl,5mM DTT,20% glycerol,pH8.0.;Stability:Recombinant Human Sorbitol Dehydrogenase/SORD Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Sorbitol Dehydrogenase/SORD Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Sorbitol Dehydrogenase Protein is produced in Human Cells and the target gene encoding Ala2-Pro357 is expressed with a His tag at the C-terminus.