• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Sorbitol Dehydrogenase / SORD Protein Online Inquiry

  • Cat#:
  • RPH-NP348
  • Product Name:
  • Recombinant Human Sorbitol Dehydrogenase / SORD Protein
  • Synonym:
  • Sorbitol Dehydrogenase, L-Iditol 2-Dehydrogenase, SORD
  • Description:
  • Recombinant Human Sorbitol Dehydrogenase Protein is produced in Human Cells and the target gene encoding Ala2-Pro357 is expressed with a His tag at the C-terminus.
  • Source:
  • Human Cells
  • AA Sequence:
  • AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPM VLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCR FYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMG AAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGI YATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRF PLEKALEAFETFKKGLGLKIMLKCDPSDQNPVDHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Sorbitol Dehydrogenase/SORD Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,0.2M NaCl,5mM DTT,20% glycerol,pH8.0.
  • Stability:
  • Recombinant Human Sorbitol Dehydrogenase/SORD Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store Recombinant Human Sorbitol Dehydrogenase/SORD Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human Sonic Hedgehog / SHH Protein I Advanced Biomart
  • Online Inquiry

    refresh