Cat#:RPH-NP356;Product Name:Recombinant Human TIGIT / VSIG9 / VSTM3 Protein;Synonym:T-cell immunoreceptor with Ig and ITIM domains,,VSIG9, VSTM3,TIGIT,V-set and transmembrane domain-containing protein 3,V-set and immunoglobulin domain-containing protein 9;Description:Recombinant Human TIGIT Protein is produced in Human Cells and the target gene encoding Met22-Pro141 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVA PGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQIPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human TIGIT/VSIG9/VSTM3 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human TIGIT/VSIG9/VSTM3 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human TIGIT protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human TIGIT protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human TIGIT protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;