Cat#:RPH-NP344;Product Name:Recombinant Human SMAD Family Member 1 / SMAD1 Protein;Synonym:Mothers Against Decapentaplegic Homolog 1, MAD Homolog 1, Mothers Against DPP Homolog 1, JV4-1, Mad-Related Protein 1, SMAD Family Member 1,Transforming Growth Factor-Beta-Signaling Protein 1, BSP-1, SMAD1, BSP1, MADH1,SMAD 1,Smad1,hSMAD1,MADR1;Description:Recombinant Human SMAD1 Protein is produced in E.coli and the target gene encoding Met1-Ser465 is expressed with a GST tag at the N-terminus.;Source:E.coli;AA Sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKA VDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQ SHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNE PHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYL PPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTS VLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSR NCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAE YHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human SMAD Family Member 1/SMAD1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0 .;Stability:Recombinant Human SMAD Family Member 1/SMAD1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human SIRPA protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human SIRPA protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human SIRPA protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;