Cat#:RPH-NP345;Product Name:Recombinant Human SMAD Family Member 4 / SMAD4 / DPC4 Protein;Synonym:Mothers Against Decapentaplegic Homolog 4, MAD Homolog 4, Mothers Against DPP Homolog 4, Deletion Target in Pancreatic Carcinoma 4, SMAD Family Member 4, SMAD 4, Smad4, hSMAD4, SMAD4, DPC4, MADH4;Description:Recombinant Human SMAD4 Protein is produced in E.coli and the target gene encoding Met1-Asp552 is expressed with a His tag at the C-terminus.;Source:E. coli;AA Sequence:MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNG AHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNP YHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETY STPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATY HHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCS IAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLE CKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQ AAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKE TPCWIEIHLHRALQLLDEVLHTMPIADPQPLDLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human SMAD Family Member 4/SMAD4/DPC4 Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl，pH8.0.;Stability:Recombinant Human SMAD Family Member 4/SMAD4/DPC4 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human SMAD4 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human SMAD4 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human SMAD4 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;