Cat#:RPH-NP343;Product Name:Recombinant Human Signal-Regulatory Protein α-1 / SIRPA / CD172a Protein;Synonym:Tyrosine-Protein Phosphatase Non-Receptor Type Substrate 1, SHP Substrate 1, SHPS-1, Brain Ig-Like Molecule with Tyrosine-Based Activation Motifs, Bit, CD172 Antigen-Like Family Member A, Inhibitory Feceptor SHPS-1, Macrophage Fusion Receptor, MyD-1 Antigen, Signal-Regulatory Protein Alpha-1, Sirp-Alpha-1, Signal-Regulatory Protein Alpha-2, Sirp-Alpha-2, Signal-Regulatory Protein Alpha-3, Sirp-Alpha-3, p84, CD172a, SIRPA, BIT, MFR, MYD1, PTPNS1, SHPS1, SIRP;Description:Recombinant Human Signal-Regulatory Protein alpha 1 Protein is produced in Human Cells and the target gene encoding Glu31-Arg370 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTTVSE STKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVSGPAARAT PQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQV ICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENG NVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQ GSNTAAENTGSNERNVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Signal-Regulatory Protein α-1/SIRPA/CD172a Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human Signal-Regulatory Protein α-1/SIRPA/CD172a Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human SIRPA protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human SIRPA protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human SIRPA protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;