Cat#:RPH-NP342;Product Name:Recombinant Human Signaling Lymphocytic Activation Molecule / SLAM / CD150 Protein;Synonym:Signaling Lymphocytic Activation Molecule, CDw150, IPO-3, CD150, SLAMF1, SLAM;Description:Recombinant Human Signaling Lymphocytic Activation Molecule Protein is produced in Human Cells and the target gene encoding Ala21-Pro237 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSE AGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLN KTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPI SNNSQTFSPWPGCRTDPSETKPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Signaling Lymphocytic Activation Molecule/SLAM/CD150 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human Signaling Lymphocytic Activation Molecule/SLAM/CD150 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human SLAM protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human SLAM protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human SLAM protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Signaling Lymphocytic Activation Molecule / SLAM / CD150 Protein
Online Inquiry
Cat#:
RPH-NP342
Product Name:
Recombinant Human Signaling Lymphocytic Activation Molecule / SLAM / CD150 Protein
Synonym:
Signaling Lymphocytic Activation Molecule, CDw150, IPO-3, CD150, SLAMF1, SLAM
Description:
Recombinant Human Signaling Lymphocytic Activation Molecule Protein is produced in Human Cells and the target gene encoding Ala21-Pro237 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Signaling Lymphocytic Activation Molecule/SLAM/CD150 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Stability:
Recombinant Human Signaling Lymphocytic Activation Molecule/SLAM/CD150 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human SLAM protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human SLAM protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human SLAM protein samples are stable below -20°C for 3 months.