Cat#:RPH-NP341;Product Name:Recombinant Human Secreted Frizzled-Related Protein 2 / sFRP-2 / SARP1 Protein;Synonym:Secreted Frizzled-Related Protein 2, FRP-2, sFRP-2, Secreted Apoptosis-Related Protein 1, SARP-1, SFRP2, FRP2, SARP1;Description:Recombinant Human Secreted Frizzled-Related Protein 2 Protein is produced in Human Cells and the target gene encoding Leu25-Cys295 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LFLFGQPDFSYKRSNCKPIPVNLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHP DTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIP LASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSK TIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFK RISRSIRKLQCVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Secreted Frizzled-Related Protein 2/sFRP-2/SARP1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human Secreted Frizzled-Related Protein 2/sFRP-2/SARP1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human SFRP2 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human SFRP2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human SFRP2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;