Cat#:RPH-NP340;Product Name:Recombinant Human Retinol-Binding Protein 4 / RBP4 Protein;Synonym:Retinol-Binding Protein 4, Plasma Retinol-Binding Protein, PRBP, RBP, RBP4;Description:Recombinant Human Retinol-Binding Protein 4 Protein is produced in E.coli and the target gene encoding Glu19-Leu201 is expressed.;Source:E.coli;AA Sequence:MERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLL NNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTC ADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Retinol-Binding Protein 4/RBP4 Protein was lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl, 10mM CaCl2, 150mM NaCl, pH 7.5 .;Stability:Recombinant Human Retinol-Binding Protein 4/RBP4 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human RBP4 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human RBP4 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human RBP4 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;