Cat#:RPH-NP339;Product Name:Recombinant Human Retinoic Acid Receptor Responder Protein 2 / Chemerin / TIG2 Protein;Synonym:Retinoic acid receptor responder protein 2, Chemerin, RAR-responsive protein TIG2, Tazarotene-induced gene 2 protein, RARRES2, TIG2;Description:Recombinant Human Chemerin Protein is produced in Human Cells and the target gene encoding Glu21-Ser157 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKP ECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYF PGQFAFSVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Retinoic Acid Receptor Responder Protein 2/Chemerin/TIG2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Retinoic Acid Receptor Responder Protein 2/Chemerin/TIG2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human Chemerinn protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human Chemerin protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human Chemerin protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;