Cat#:RPH-NP325;Product Name:Recombinant Human Pro-Brain-Derived Neurotrophic Factor / pro-BDNF Protein;Synonym:Brain-Derived Neurotrophic Factor, BDNF, Abrineurin;Description:Recombinant Human pro-Brain-Derived Neurotrophic Factor Protein is produced in E.coli and the target gene encoding Ala19-Arg247 is expressed.;Source:E.coli;AA Sequence:MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEE NNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEW VTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQ SYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Pro-Brain-Derived Neurotrophic Factor/pro-BDNF Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.2.;Stability:Recombinant Human Pro-Brain-Derived Neurotrophic Factor/pro-BDNF Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human pro-BDNF protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human pro-BDNF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human pro-BDNF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;