Cat#:RPH-NP326;Product Name:Recombinant Human Prolyl 4-Hydroxylase Subunit β / P4HB / PDIA1 Protein;Synonym:Protein Disulfide-Isomerase, PDI, Cellular Thyroid Hormone-Binding Protein, Prolyl 4-Hydroxylase Subunit Beta, p55, P4HB, ERBA2L, PDI, PDIA1, PO4DB;Description:Recombinant Human Prolyl 4-Hydroxylase Subunit Beta Protein is produced in E.coli and the target gene encoding Asp18-Lys505 is expressed with a His tag at the C-terminus.;Source:E. coli;AA Sequence:DAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKV DATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAE SLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEG RNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKT AAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEF CHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIW DKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES GGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein was supplied as a 0.2 μm filtered solution of PBS, pH 7.4.;Stability:Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Prolyl 4-Hydroxylase Subunit Beta Protein is produced in E.coli and the target gene encoding Asp18-Lys505 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein was supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
Stability:
Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.