• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Prolyl 4-Hydroxylase Subunit β / P4HB / PDIA1 Protein Online Inquiry

  • Cat#:
  • RPH-NP326
  • Product Name:
  • Recombinant Human Prolyl 4-Hydroxylase Subunit β / P4HB / PDIA1 Protein
  • Synonym:
  • Protein Disulfide-Isomerase, PDI, Cellular Thyroid Hormone-Binding Protein, Prolyl 4-Hydroxylase Subunit Beta, p55, P4HB, ERBA2L, PDI, PDIA1, PO4DB
  • Description:
  • Recombinant Human Prolyl 4-Hydroxylase Subunit Beta Protein is produced in E.coli and the target gene encoding Asp18-Lys505 is expressed with a His tag at the C-terminus.
  • Source:
  • E. coli
  • AA Sequence:
  • DAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKV DATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAE SLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEG RNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKT AAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEF CHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIW DKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLES GGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKVDHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein was supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
  • Stability:
  • Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store Recombinant Human Prolyl 4-Hydroxylase Subunit β/P4HB/PDIA1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human pro-BDNF Protein I Advanced Biomart
  • Online Inquiry

    refresh