Cat#:RPH-NP319;Product Name:Recombinant Human Platelet-Derived Growth Factor BB / PDGFBB Protein;Synonym:Platelet-Derived Growth Factor Subunit B, PDGF Subunit B, PDGF-2, Platelet-Derived Growth Factor B Chain, Platelet-Derived Growth Factor Beta Polypeptide, Proto-Oncogene c-Sis, Becaplermin, PDGFB, PDGF2, SIS;Description:Recombinant Human Platelet-Derived Growth Factor BB Protein is produced in E.coli and the target gene encoding Ser82-Thr190 is expressed.;Source:E.coli;AA Sequence:MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQ VQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Platelet-Derived Growth Factor BB/PDGFBB Protein was lyophilized from a 0.2 μm filtered solution of 4mM HCl.;Stability:Recombinant Human Platelet-Derived Growth Factor BB/PDGFBB Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human PDGFBB protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human PDGFBB protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PDGFBB protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;