Cat#:RPH-NP318;Product Name:Recombinant Human Platelet-Derived Growth Factor AA / PDGFAA Protein(His Tag);Synonym:Platelet-derived growth factor subunit A,PDGF subunit A,PDGF-1,Platelet-derived growth factor A chain,Platelet-derived growth factor alpha polypeptide, PDGFA,PDGF1;Description:Recombinant Human Platelet-derived growth factor AA Protein is produced in E.coli and the target gene encoding Ser87-Thr211 is expressed with a His tag at the N-terminus.;Source:E. coli;AA Sequence:MNHKVHHHHHHMSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVK CQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRK RKRLKPT;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Platelet-Derived Growth Factor AA/PDGFAA Protein (His Tag)was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human Platelet-Derived Growth Factor AA/PDGFAA Protein (His Tag)is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human PDGFAA protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human PDGFAA protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PDGFAA protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;