Cat#:RPH-NP320;Product Name:Recombinant Human Platelet-Derived Growth Factor Receptor β / PDGFR-β Protein;Synonym:Platelet-Derived Growth Factor Receptor Beta, PDGF-R-Beta, PDGFR-Beta, Beta Platelet-Derived Growth Factor Receptor, Beta-Type Platelet-Derived Growth Factor Receptor, CD140 Antigen-Like Family Member B, Platelet-Derived Growth Factor Receptor 1, PDGFR-1, CD140b, PDGFRB, PDGFR, PDGFR1;Description:Recombinant Human PDGF receptor beta Protein is produced in Human Cells and the target gene encoding Leu33-Phe530 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGE YFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHE KKGDVALPVPYDHQRGFFGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQ GENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCN VTESVNDHQDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTL GDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVLEL SESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQ EFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Platelet-Derived Growth Factor Receptor β/PDGFR-β Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human Platelet-Derived Growth Factor Receptor β/PDGFR-β Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human PDGFR-β protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human PDGFR-β protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human PDGFR-β protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;