Cat#:RP-3871H;Product Name:Recombinant Human HPV 18 Protein;Synonym:Papillomavirus, HPV, Papilloma Virus.;Description:The Recombinant HPV-18 is a full length large capsid protein having a Mw of 56kDa expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography.;Source:E.coli;AA Sequence:VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGG NKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVE IGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQ LCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTG YGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRRE QLFAR;Purity:Protein is Greater than 90% pure as determined by 10% PAGE (Coomassie staining).;Formulation:Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;