Cat#:RP-3872H;Product Name:Recombinant Human HPV 6 Protein;Synonym:Papillomavirus, HPV, Papilloma Virus.;Description:Recombinant HPV6 antigen is a 55.6kDa protein covering the full length of HPV6 major capsid, its N-terminus is fused with a GST tag, having a total Mw of 81.6kDa. The HPV6 was Purified by proprietary chromatographic technique.;Source:E.coli.;AA Sequence:VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVP KVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGV GVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEH WGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDV PIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNR;Purity:Protein is Greater than 95% pure as determined by 10% PAGE (coomassie staining).;Formulation:PBS and 3M Urea.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Recombinant HPV-6 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.;