Cat#:RP-3870H;Product Name:Recombinant Human HPV 16 Protein;Synonym:Papillomavirus, HPV, Papilloma Virus.;Description:The Recombinant HPV-16 antigen is a full length protein expressed in E. coli having an Mw of 56.7kDa. The protein is fused to a 26kDa GST-Tag, having a total Mw of 82.7kDA and purified by standard chromatography.;Source:E.coli.;AA Sequence:MQVTFIYILVITCYENDVNVYHIFFQMSLWLPSEATVYLPPVPVSKVVSTDEYVARTN IYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSF YNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECIS MDYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFG AMDFTTLQANKSEVPLDIC;Purity:Protein is Greater than 90% pure as determined by 10% SDS-PAGE (Coomassie staining).;Formulation:Recombinant HPV-16 solution in PBS, 100mM arginine and 3M Urea.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Recombinant HPV-16 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.;