Cat#:RP-3869H;Product Name:Recombinant Human HPV 11 Protein;Synonym:Papillomavirus, HPV, Papilloma Virus.;Description:Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.;Source:E.coli.;AA Sequence:VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPK VSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDD VENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELIT SVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRK;Purity:Protein is Greater than 90% pure as determined by 10% PAGE (coomassie staining).;Formulation:Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.;