Cat#:RPH-NP171;Product Name:Recombinant Human Granulocyte Colony-Stimulating Factor / G-CSF Protein;Synonym:Granulocyte Colony-Stimulating Factor, G-CSF, Pluripoietin, Filgrastim, Lenograstim, CSF3, C17orf33, GCSF;Description:Recombinant Human Granulocyte Colony-Stimulating Factor Protein is produced in E.coli and the target gene encoding Thr31-Pro204 is expressed.;Source:E. coli;AA Sequence:MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSC PSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPA LQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:ED50 is less than 0.1 ng/ml. Specific Activity of 6.0 x 10^7 IU/ mg, measured by the dose-dependent proliferation of murine NFS-60 indicator cells.;Formulation:Recombinant Human Granulocyte Colony-Stimulating Factor/G-CSF Protein was lyophilized from a 0.2 μm filtered solution of 10mM HAc-NaAc, 150mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0.;Stability:Recombinant Human Granulocyte Colony-Stimulating Factor/G-CSF Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human G-CSF protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human G-CSF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human G-CSF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;