Cat#:RPH-NP172;Product Name:Recombinant Human Group XVI Phospholipase A1 / A2 / PLA2G16 Protein;Synonym:Group XVI Phospholipase A1/A2, Adipose-Specific Phospholipase A2, AdPLA, H-Rev 107 Protein Homolog, HRAS-Like Suppressor 1, HRAS-Like Suppressor 3, HRSL3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, PLA2G16, HRASLS3, HREV107;Description:Recombinant Human PLA2G16 Protein is produced in E.coli and the target gene encoding Asp12-Asp132 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALT DKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL RYGVARSDQVRD;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:IN STOCK;Formulation:Recombinant Human Group XVI Phospholipase A1/A2/PLA2G16 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.;Stability:Recombinant Human Group XVI Phospholipase A1/A2/PLA2G16 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human PLA2G16 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;