Cat#:RPH-NP170;Product Name:Recombinant Human GPD1 / GDP-C Protein;Synonym:Glycerol-3-Phosphate Dehydrogenase [NAD(+)] Cytoplasmic, GPD-C, GPDH-C, GPD1;Description:Recombinant Human GPD1 Protein is produced in Human Cells and the target gene encoding Met1-Met349 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLP GHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLK LISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVD TVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGPVSSATFLESCGVAD LITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFPLFMAV YKVCYEGQPVGEFIHCLQNHPEHMVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human GPD1/GDP-C Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 10% Glycerol, pH 8.0.;Stability:Recombinant Human GPD1/GDP-C Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human GPD1/GDP-C Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;