Cat#:RP-15981H;Product Name:Recombinant Human TNFRSF12A Protein, GST Tag;Synonym:FN14; CD266; TWEAKR; TNF receptor superfamily member 12A; FGF-inducible 14; fibroblast growth factor-inducible immediate-early response protein 14; tweak-receptor; type I transmembrane protein Fn14;Background:TNFRSF12A, the full name is TNF receptor superfamily member 12A. Gene ID is 51330. Tumor necrosis factor receptor superfamily member 12A also known as the TWEAK receptor (TWEAKR) is a protein that in humans is encoded by the TNFRSF12A gene.;Source:E. coli;AA Sequence:LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV ;Molecular Characterization:35 kDa;Stability:Recombinant TNFRSF12A Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:Reconstitute the recombinant human TNFRSF12A protein at 0.25 µg/μl in 200 μl sterile water for short-term storage. ;Host Species:Human;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;References:Knockdown of the differentially expressed gene TNFRSF12A inhibits hepatocellular carcinoma cell proliferation and migration in vitro. Wang T, et al. Mol Med Rep, 2017 Mar. PMID 28138696;