Rabbit anti-Human MOB1A/MOB1B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07238P

• Product Name:
• Rabbit anti-Human MOB1A/MOB1B Polyclonal Antibody

• Synonym:
• MOB1A/MOB1B

• Description:
• The antibody against MOB1A/MOB1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB1A/MOB1B (NP_060691.2/NP_775739.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB1A/MOB1B (NP_060691.2/NP_775739.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MOB1A/MOB1B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR/MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAE

• Gene ID:
• 5523392597

• Uniprot-ID:
• Q9H8S9

• Purification Method:
• Affinity purification

• Positive Samples:
• K-562, Daudi, NIH/3T3, C6, C2C12