Rabbit anti-Human COL16A1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07239P

• Product Name:
• Rabbit anti-Human COL16A1 Polyclonal Antibody

• Synonym:
• 447AA; FP1572; COL16A1

• Description:
• The antibody against COL16A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human COL16A1 (NP_001847.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human COL16A1 (NP_001847.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• COL16A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PRAEEARGDNSEGDPGCVGSPGLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDKGEPGPPGQPGYPGATGPPGL

• Gene ID:
• 1307

• Uniprot-ID:
• Q07092

• Purification Method:
• Affinity purification

• Positive Samples:
• PC-3, Mouse kidney, Mouse heart