Rabbit anti-Human MRPL55 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07237P

• Product Name:
• Rabbit anti-Human MRPL55 Polyclonal Antibody

• Synonym:
• L55nt; MRP-L55; AAVG5835; PRO19675; MRPL55

• Description:
• The antibody against MRPL55 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL55 (NP_001308213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL55 (NP_001308213.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MRPL55

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK

• Gene ID:
• 128308

• Uniprot-ID:
• Q7Z7F7

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7